PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_37851g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 417aa    MW: 46873.1 Da    PI: 6.5917
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_37851g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding452.4e-142069148
                     TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+ ++ + G+   +W+ Ia+  g+ R++k+c++rw +yl
    MA_37851g0010 20 KGLWSPEEDEKLITYIMKKGMLgcSWTNIAKQAGLQRCGKSCRLRWINYL 69
                     678*****************999*************************97 PP

2Myb_DNA-binding46.21e-1475118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++++++l+ +++  lG++ W+ Ia+ ++ gRt++++k++w++
    MA_37851g0010  75 RGSFSPQDEQLIRHLHSILGNR-WSQIAASLP-GRTDNEIKNYWNT 118
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-211572IPR009057Homeodomain-like
PROSITE profilePS5129415.5571569IPR017930Myb domain
SuperFamilySSF466893.13E-2617116IPR009057Homeodomain-like
SMARTSM007174.4E-101971IPR001005SANT/Myb domain
PfamPF139219.7E-142384No hitNo description
CDDcd001671.09E-92369No hitNo description
PROSITE profilePS5129425.06470124IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2473123IPR009057Homeodomain-like
SMARTSM007172.4E-1474122IPR001005SANT/Myb domain
CDDcd001673.67E-1077118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MWCTPEQDVP LVSPTPKLRK GLWSPEEDEK LITYIMKKGM LGCSWTNIAK QAGLQRCGKS  60
CRLRWINYLR PDLKRGSFSP QDEQLIRHLH SILGNRWSQI AASLPGRTDN EIKNYWNTCI  120
KKKKLKHNSG SSSKSDIASE SDRTCNTFSA STQDAFMVSQ SAMPEMFYPE PPSKTIHQGV  180
SSVENQYSCV DPDVLGSVKH RVQLPDFSID PDSISNQLIS SSQMWINSIS TQTQYEICNS  240
LKEERKNDGE ITSHENEIMM NYSAITACSA NSHSNAADFT DVLHVALIRI QMQLILLMSL  300
YQLVPLKSQE LVSWKIIITK ALMRKLTINV DPFCNVQAET KQDDYKDLVN SRYGEVNLGV  360
PTNRQKSYQL PQIGGVHISN QWNVTETSTT LGGEASGPLE FECEGAAGQV TVWPQDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27161233107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1119150.0BT111915.1 Picea glauca clone GQ03307_H16 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA5JYE85e-74A5JYE8_PICGL; R2R3-MYB transcription factor MYB4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.12e-55myb domain protein 83